Class b: All beta proteins [48724] (141 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (12 families) |
Family b.82.1.1: dTDP-sugar isomerase [51183] (2 proteins) |
Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (5 species) synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase |
Species Streptococcus suis [89402] (3 PDB entries) |
Domain d1nxma_: 1nxm A: [86385] |
PDB Entry: 1nxm (more details), 1.3 Å
SCOP Domain Sequences for d1nxma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis} nffgktlaarpveaipgmlefdipvhgdnrgwfkenfqkekmlplgfpesffaegklqnn vsfsrknvlrglhaepwdkyisvadggkvlgtwvdlregetfgntyqtvidasksifvpr gvangfqvlsdfvaysylvndywalelkpkyafvnyadpsldikwenleeaevseadenh pflkdvkplrkedl
Timeline for d1nxma_: