SCOPe 2.01: Domain d1nvie_: 1nvi E:

Lineage for d1nvie_ (1nvi E:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)

6. Protein Molybdopterin synthase subunit MoaE [54692] (1 species)

7. Species Escherichia coli [TaxId:562] [54693] (5 PDB entries)

8. Domain d1nvie_: 1nvi E: [86242]
   Other proteins in same PDB: d1nvid_
   complexed with MoaD
   complexed with gol, so4

Details for d1nvie_

PDB Entry: 1nvi, 1.9 Å

PDB Description: orthorhombic crystal form of molybdopterin synthase

PDB Compounds: (E:) Molybdopterin converting factor subunit 2

SCOPe Domain Sequences for d1nvie_:

Sequence, based on SEQRES records:

>d1nvie_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkreatpegdrwvearesdqqaakrw

Sequence, based on observed residues (ATOM records):

>d1nvie_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
atpegdrwvearesdqqaakrw

Timeline for d1nvie_:

• d1nvie_ first appeared in SCOP 1.65
  
• d1nvie_ appears in SCOP 1.75
  
• d1nvie_ appears in SCOPe 2.02
  
• d1nvie_ appears in the current release, SCOPe 2.08