Lineage for d1nr9b_ (1nr9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004669Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 3004719Protein Putative isomerase YcgM [90070] (1 species)
  7. 3004720Species Escherichia coli [TaxId:562] [90071] (1 PDB entry)
  8. 3004722Domain d1nr9b_: 1nr9 B: [86120]
    Other proteins in same PDB: d1nr9a2, d1nr9a3, d1nr9c2, d1nr9d2
    structural genomics
    complexed with mg

Details for d1nr9b_

PDB Entry: 1nr9 (more details), 2.7 Å

PDB Description: Crystal Structure of Escherichia coli 1262 (APC5008), Putative Isomerase
PDB Compounds: (B:) Protein YCGM

SCOPe Domain Sequences for d1nr9b_:

Sequence, based on SEQRES records: (download)

>d1nr9b_ d.177.1.1 (B:) Putative isomerase YcgM {Escherichia coli [TaxId: 562]}
myqhhnwqgalldypvskvvcvgsnyakhikemgsavpeepvlfikpetalcdlrqplai
psdfgsvhhevelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwek
akafdnscplsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymskff
tlkagdvvltgtpdgvgplqsgdeltvtfdghslttrvl

Sequence, based on observed residues (ATOM records): (download)

>d1nr9b_ d.177.1.1 (B:) Putative isomerase YcgM {Escherichia coli [TaxId: 562]}
myqhhnwqgalldypvskvvcvgsnyavpeepvlfikpetalcdlrqplaipsdfgsvhh
evelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwekakafdnscp
lsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymskfftlkagdvvl
tgtpdgvgplqsgdeltvtfdghslttrvl

SCOPe Domain Coordinates for d1nr9b_:

Click to download the PDB-style file with coordinates for d1nr9b_.
(The format of our PDB-style files is described here.)

Timeline for d1nr9b_: