![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein Coenzyme A pyrophosphatase [90022] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [90023] (2 PDB entries) |
![]() | Domain d1nqya_: 1nqy A: [86076] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1nqy (more details), 2.09 Å
SCOPe Domain Sequences for d1nqya_:
Sequence, based on SEQRES records: (download)
>d1nqya_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} hdplddiqadpwalwlsgrtrtalelphyrraavlvaltreadprvlltvrsselpthkg qiafpggsldagetptqaalreaqeevaldpaavtllgelddvftpvgfhvtpvlgriap ealdtlrvtpevaqiitptlaelravplvrerrtlpdgtevplyrypwrgldiwgmtarv lhdlle
>d1nqya_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} hdplddiqadpwalwlsgyrraavlvaltreadprvlltvrskgqiafpggsldagetpt qaalreaqeevaldpaavtllgelddvftpvgfhvtpvlgriapealdtlrvtpevaqii tptlaelravplvrerrtlpdgtevplyrypwrgldiwgmtarvlhdlle
Timeline for d1nqya_: