Lineage for d1nm4a_ (1nm4 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1112301Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
  6. 1112302Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species)
  7. 1112308Species Pseudomonas syringae [TaxId:317] [81971] (4 PDB entries)
  8. 1112310Domain d1nm4a_: 1nm4 A: [85870]

Details for d1nm4a_

PDB Entry: 1nm4 (more details)

PDB Description: solution structure of cu(i)-copc from pseudomonas syringae
PDB Compounds: (A:) copper resistance protein c

SCOPe Domain Sequences for d1nm4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nm4a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Pseudomonas syringae [TaxId: 317]}
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk

SCOPe Domain Coordinates for d1nm4a_:

Click to download the PDB-style file with coordinates for d1nm4a_.
(The format of our PDB-style files is described here.)

Timeline for d1nm4a_: