Lineage for d1njic2 (1nji C:1-90)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297600Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 297648Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    lacks the last strand
  7. 297649Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (12 PDB entries)
    includes the N-terminal tail
  8. 297653Domain d1njic2: 1nji C:1-90 [85793]
    Other proteins in same PDB: d1nji1_, d1nji2_, d1nji3_, d1nji4_, d1njic1, d1njid_, d1njie_, d1njif_, d1njig1, d1njig2, d1njih_, d1njii_, d1njij_, d1njik_, d1njil_, d1njim_, d1njin_, d1njio_, d1njip_, d1njiq_, d1njir_, d1njis_, d1njit_, d1njiu_, d1njiv_, d1njiw_, d1njix_, d1njiy_, d1njiz_
    complexed with cd, cl, clm, k, mg, na; mutant

Details for d1njic2

PDB Entry: 1nji (more details), 3 Å

PDB Description: Structure of chloramphenicol bound to the 50S ribosomal subunit

SCOP Domain Sequences for d1njic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njic2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

SCOP Domain Coordinates for d1njic2:

Click to download the PDB-style file with coordinates for d1njic2.
(The format of our PDB-style files is described here.)

Timeline for d1njic2: