Lineage for d1nj3a_ (1nj3 A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464854Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (1 family) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 1464855Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 1464863Protein Npl4 [90215] (1 species)
    a ubiquitin-interacting domain
  7. 1464864Species Norway rat (Rattus norvegicus) [TaxId:10116] [90216] (2 PDB entries)
  8. 1464866Domain d1nj3a_: 1nj3 A: [85761]
    complexed with zn

Details for d1nj3a_

PDB Entry: 1nj3 (more details)

PDB Description: structure and ubiquitin interactions of the conserved nzf domain of npl4
PDB Compounds: (A:) npl4

SCOPe Domain Sequences for d1nj3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj3a_ g.41.11.1 (A:) Npl4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gstsamwacqhctfmnqpgtghcemcslprt

SCOPe Domain Coordinates for d1nj3a_:

Click to download the PDB-style file with coordinates for d1nj3a_.
(The format of our PDB-style files is described here.)

Timeline for d1nj3a_: