PDB entry 1nj3

View 1nj3 on RCSB PDB site
Description: Structure and Ubiquitin Interactions of the Conserved NZF Domain of Npl4
Class: protein binding
Keywords: NZF domain, Npl4, rubredoxin knuckle, beta-ribbon, zinc-finger, ubiquitin, PROTEIN BINDING
Deposited on 2002-12-30, released 2003-04-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: npl4
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Npl4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ES54 (2-30)
    • cloning artifact (0-1)
  Domains in SCOPe 2.03: d1nj3a_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nj3A (A:)
  gstsamwacqhctfmnqpgtghcemcslprt