Lineage for d1ni4c_ (1ni4 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162856Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1162890Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 1162891Species Human (Homo sapiens) [TaxId:9606] [89652] (2 PDB entries)
  8. 1162895Domain d1ni4c_: 1ni4 C: [85731]
    Other proteins in same PDB: d1ni4b1, d1ni4b2, d1ni4d1, d1ni4d2
    complexed with k, mg, tpp

Details for d1ni4c_

PDB Entry: 1ni4 (more details), 1.95 Å

PDB Description: human pyruvate dehydrogenase
PDB Compounds: (C:) Pyruvate dehydrogenase E1 component: Alpha subunit

SCOPe Domain Sequences for d1ni4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni4c_ c.36.1.11 (C:) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
sfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
nmaalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrf
aaaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiqevrsksdpimllkdrmvnsn
lasveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfks
vs

SCOPe Domain Coordinates for d1ni4c_:

Click to download the PDB-style file with coordinates for d1ni4c_.
(The format of our PDB-style files is described here.)

Timeline for d1ni4c_: