Lineage for d1ngmb1 (1ngm B:437-506)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2273117Fold j.104: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90297] (1 superfamily)
  4. 2273118Superfamily j.104.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90298] (1 family) (S)
  5. 2273119Family j.104.1.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90299] (1 protein)
  6. 2273120Protein TBP-binding domain of the transcription factor IIIb Brf1 subunit [90300] (1 species)
  7. 2273121Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90301] (1 PDB entry)
  8. 2273122Domain d1ngmb1: 1ngm B:437-506 [85687]
    Other proteins in same PDB: d1ngma1, d1ngma2, d1ngmb2, d1ngme1, d1ngme2, d1ngmf2, d1ngmi1, d1ngmi2, d1ngmm1, d1ngmm2
    protein/DNA complex

Details for d1ngmb1

PDB Entry: 1ngm (more details), 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex
PDB Compounds: (B:) Transcription factor IIIB BRF1 subunit

SCOPe Domain Sequences for d1ngmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngmb1 j.104.1.1 (B:437-506) TBP-binding domain of the transcription factor IIIb Brf1 subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ycprnlhllpttdtylskvsddpdnledvddeelnahllneeasklkeriwiglnadfll
eqeskrlkqe

SCOPe Domain Coordinates for d1ngmb1:

Click to download the PDB-style file with coordinates for d1ngmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ngmb1: