Lineage for d1nfgb1 (1nfg B:1-51,B:382-457)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084271Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2084272Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2084333Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 2084334Protein D-hydantoinase [75045] (4 species)
  7. 2084347Species Burkholderia pickettii [TaxId:329] [89437] (1 PDB entry)
  8. 2084349Domain d1nfgb1: 1nfg B:1-51,B:382-457 [85634]
    Other proteins in same PDB: d1nfga2, d1nfgb2, d1nfgc2, d1nfgd2
    complexed with zn

Details for d1nfgb1

PDB Entry: 1nfg (more details), 2.7 Å

PDB Description: Structure of D-hydantoinase
PDB Compounds: (B:) D-hydantoinase

SCOPe Domain Sequences for d1nfgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfgb1 b.92.1.3 (B:1-51,B:382-457) D-hydantoinase {Burkholderia pickettii [TaxId: 329]}
mdiiikngtivtadgisradlgikdgkitqiggalgpaertidaagryvfpXiavgsdad
ivlwdpeaemvieqtamhnamdyssyeghkvkgvpktvllrgkvivdegsyvgeptdgkf
lkrrkykq

SCOPe Domain Coordinates for d1nfgb1:

Click to download the PDB-style file with coordinates for d1nfgb1.
(The format of our PDB-style files is described here.)

Timeline for d1nfgb1: