SCOP 1.73: Domain d1mxza_: 1mxz A:

Lineage for d1mxza_ (1mxz A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (53 PDB entries)

8. Domain d1mxza_: 1mxz A: [85214]

Details for d1mxza_

PDB Entry: 1mxz, 1.9 Å

PDB Description: crystal titration experiments (ampa co-crystals soaked in 1 um brw)

PDB Compounds: (A:) Glutamate receptor 2

SCOP Domain Sequences for d1mxza_:

Sequence; same for both SEQRES and ATOM records:

>d1mxza_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d1mxza_:

• d1mxza_ first appeared in SCOP 1.65
  
• d1mxza_ appears in SCOP 1.71
  
• d1mxza_ appears in SCOP 1.75
  
• d1mxza_ appears in the current release, SCOPe 2.08