Lineage for d1mvfe_ (1mvf E:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 305027Fold b.129: Kis/PemI addiction antidote [89446] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 305028Superfamily b.129.1: Kis/PemI addiction antidote [89447] (1 family) (S)
    forms intertwinned homodimer
  5. 305029Family b.129.1.1: Kis/PemI addiction antidote [89448] (1 protein)
  6. 305030Protein MazE [89449] (1 species)
  7. 305031Species Escherichia coli [TaxId:562] [89450] (2 PDB entries)
  8. 305033Domain d1mvfe_: 1mvf E: [85144]
    Other proteins in same PDB: d1mvfa_, d1mvfb_
    complex with camelid antibody VHh

Details for d1mvfe_

PDB Entry: 1mvf (more details), 1.65 Å

PDB Description: MazE addiction antidote

SCOP Domain Sequences for d1mvfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvfe_ b.129.1.1 (E:) MazE {Escherichia coli}
ssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepv

SCOP Domain Coordinates for d1mvfe_:

Click to download the PDB-style file with coordinates for d1mvfe_.
(The format of our PDB-style files is described here.)

Timeline for d1mvfe_: