SCOPe 2.02: Domain d1muqc_: 1muq C:

Lineage for d1muqc_ (1muq C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Galactose-specific C-type lectin [90061] (1 species)

7. Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries)

8. Domain d1muqc_: 1muq C: [85113]
   complexed with ca, gal, na, tdg

Details for d1muqc_

PDB Entry: 1muq, 2.3 Å

PDB Description: x-ray crystal structure of rattlesnake venom complexed with thiodigalactoside

PDB Compounds: (C:) Galactose-specific lectin

SCOPe Domain Sequences for d1muqc_:

Sequence; same for both SEQRES and ATOM records:

>d1muqc_ d.169.1.1 (C:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]}
ncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyhk
gqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwndq
vceskdaflcqckf

Timeline for d1muqc_:

• d1muqc_ first appeared in SCOP 1.65
  
• d1muqc_ appears in SCOPe 2.01
  
• d1muqc_ appears in SCOPe 2.03
  
• d1muqc_ appears in the current release, SCOPe 2.08