Lineage for d1mtcb1 (1mtc B:85-217)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735827Protein Class mu GST [81348] (3 species)
  7. 1735889Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 1735915Domain d1mtcb1: 1mtc B:85-217 [85105]
    Other proteins in same PDB: d1mtca2, d1mtcb2
    complexed with gpr; mutant

Details for d1mtcb1

PDB Entry: 1mtc (more details), 2.2 Å

PDB Description: glutathione transferase mutant y115f
PDB Compounds: (B:) Glutathione S-transferase YB1

SCOPe Domain Sequences for d1mtcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mtcb1 a.45.1.1 (B:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcfnpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOPe Domain Coordinates for d1mtcb1:

Click to download the PDB-style file with coordinates for d1mtcb1.
(The format of our PDB-style files is described here.)

Timeline for d1mtcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mtcb2