Lineage for d1mpxc2 (1mpx C:24-404)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 319445Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 319446Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 319918Family c.69.1.21: PepX catalytic domain-like [69581] (3 proteins)
  6. 319919Protein Alpha-amino acid ester hydrolase [89769] (1 species)
  7. 319920Species Xanthomonas citri [TaxId:346] [89770] (1 PDB entry)
  8. 319923Domain d1mpxc2: 1mpx C:24-404 [85046]
    Other proteins in same PDB: d1mpxa1, d1mpxb1, d1mpxc1, d1mpxd1

Details for d1mpxc2

PDB Entry: 1mpx (more details), 1.9 Å

PDB Description: alpha-amino acid ester hydrolase labeled with selenomethionine

SCOP Domain Sequences for d1mpxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpxc2 c.69.1.21 (C:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri}
tspmtpditgkpfvaadasndyikrevmipmrdgvklhtvivlpkgaknapivltrtpyd
asgrterlasphmkdllsagddvfveggyirvfqdvrgkygsegdyvmtrplrgplnpse
vdhatdawdtidwlvknvsesngkvgmigssyegftvvmaltnphpalkvavpespmidg
wmgddwfnygafrqvnfdyftgqlskrgkgagiarqghddysnflqagsagdfakaagle
qlpwwhkltehaaydafwqeqaldkvmartplkvptmwlqglwdqedmwgaihsyaamep
rdkrntlnylvmgpwrhsqvnydgsalgalnfegdtarqfrhdvlrpffdqylvdgapka
dtppvfiyntgenhwdrlkaw

SCOP Domain Coordinates for d1mpxc2:

Click to download the PDB-style file with coordinates for d1mpxc2.
(The format of our PDB-style files is described here.)

Timeline for d1mpxc2: