SCOP 1.65: Domain d1ml6b2: 1ml6 B:302-379

Lineage for d1ml6b2 (1ml6 B:302-379)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Mouse (Mus musculus), (a2-2) [TaxId:10090] [89703] (1 PDB entry)

8. Domain d1ml6b2: 1ml6 B:302-379 [85012]
   Other proteins in same PDB: d1ml6a1, d1ml6b1
   complexed with cso, gbx, ioh

Details for d1ml6b2

PDB Entry: 1ml6, 1.9 Å

PDB Description: Crystal Structure of mGSTA2-2 in Complex with the Glutathione Conjugate of Benzo[a]pyrene-7(R),8(S)-Diol-9(S),10(R)-Epoxide

SCOP Domain Sequences for d1ml6b2:

Sequence; same for both SEQRES and ATOM records:

>d1ml6b2 c.47.1.5 (B:302-379) Class alpha GST {Mouse (Mus musculus), (a2-2)}
gkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveidg
mklvqtrailnyiatkyd

Timeline for d1ml6b2:

• d1ml6b2 is new in SCOP 1.65
  
• d1ml6b2 appears in SCOP 1.67
  
• d1ml6b2 appears in the current release, SCOPe 2.08