Lineage for d1ml3c2 (1ml3 C:165-333)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568241Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2568332Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2568544Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries)
  8. 2568559Domain d1ml3c2: 1ml3 C:165-333 [85006]
    Other proteins in same PDB: d1ml3a1, d1ml3b1, d1ml3c1, d1ml3d1
    complexed with cyx, nad

Details for d1ml3c2

PDB Entry: 1ml3 (more details), 2.5 Å

PDB Description: Evidences for a flip-flop catalytic mechanism of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase, from its crystal structure in complex with reacted irreversible inhibitor 2-(2-phosphono-ethyl)-acrylic acid 4-nitro-phenyl ester
PDB Compounds: (C:) Glyceraldehyde 3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d1ml3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml3c2 d.81.1.1 (C:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOPe Domain Coordinates for d1ml3c2:

Click to download the PDB-style file with coordinates for d1ml3c2.
(The format of our PDB-style files is described here.)

Timeline for d1ml3c2: