SCOPe 2.08: Domain d1ml3c2: 1ml3 C:165-333

Lineage for d1ml3c2 (1ml3 C:165-333)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)

7. Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries)

8. Domain d1ml3c2: 1ml3 C:165-333 [85006]
   Other proteins in same PDB: d1ml3a1, d1ml3b1, d1ml3c1, d1ml3d1
   complexed with cyx, nad

Details for d1ml3c2

PDB Entry: 1ml3, 2.5 Å

PDB Description: Evidences for a flip-flop catalytic mechanism of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase, from its crystal structure in complex with reacted irreversible inhibitor 2-(2-phosphono-ethyl)-acrylic acid 4-nitro-phenyl ester

PDB Compounds: (C:) Glyceraldehyde 3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d1ml3c2:

Sequence; same for both SEQRES and ATOM records:

>d1ml3c2 d.81.1.1 (C:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

Timeline for d1ml3c2:

• d1ml3c2 first appeared in SCOP 1.65
  
• d1ml3c2 appears in SCOPe 2.07