Lineage for d1m9xg_ (1m9x G:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091822Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1091823Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 1091824Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1091863Protein HIV-1 capsid protein [47945] (1 species)
  7. 1091864Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (19 PDB entries)
  8. 1091873Domain d1m9xg_: 1m9x G: [84911]
    Other proteins in same PDB: d1m9xa_, d1m9xb_, d1m9xe_, d1m9xf_

Details for d1m9xg_

PDB Entry: 1m9x (more details), 1.7 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m,g89a complex.
PDB Compounds: (G:) hiv-1 capsid

SCOPe Domain Sequences for d1m9xg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9xg_ a.73.1.1 (G:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvamapiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOPe Domain Coordinates for d1m9xg_:

Click to download the PDB-style file with coordinates for d1m9xg_.
(The format of our PDB-style files is described here.)

Timeline for d1m9xg_: