Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) |
Family d.58.48.1: MTH1187-like [89958] (5 proteins) Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix |
Protein Hypothetical protein YB1001C [89961] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89962] (1 PDB entry) |
Domain d1lxja_: 1lxj A: [84736] structural genomics; NESG target Ytyst72 complexed with so4 |
PDB Entry: 1lxj (more details), 1.8 Å
SCOPe Domain Sequences for d1lxja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxja_ d.58.48.1 (A:) Hypothetical protein YB1001C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mpkifcladvcmvpigtdsasisdfvaliekkiresplkstlhsagttiegpwddvmgli geiheyghekgyvrvhtdirvgtrtdkhqtaqdkidvvlkkisq
Timeline for d1lxja_: