Lineage for d1lxja_ (1lxj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955711Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. 2955712Family d.58.48.1: MTH1187-like [89958] (5 proteins)
    Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 2955734Protein Hypothetical protein YB1001C [89961] (1 species)
  7. 2955735Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89962] (1 PDB entry)
  8. 2955736Domain d1lxja_: 1lxj A: [84736]
    structural genomics; NESG target Ytyst72
    complexed with so4

Details for d1lxja_

PDB Entry: 1lxj (more details), 1.8 Å

PDB Description: x-ray structure of ybl001c northeast structural genomics (nesg) consortium target ytyst72
PDB Compounds: (A:) hypothetical 11.5kda protein in htb2-nth2 intergenic region

SCOPe Domain Sequences for d1lxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxja_ d.58.48.1 (A:) Hypothetical protein YB1001C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mpkifcladvcmvpigtdsasisdfvaliekkiresplkstlhsagttiegpwddvmgli
geiheyghekgyvrvhtdirvgtrtdkhqtaqdkidvvlkkisq

SCOPe Domain Coordinates for d1lxja_:

Click to download the PDB-style file with coordinates for d1lxja_.
(The format of our PDB-style files is described here.)

Timeline for d1lxja_: