Lineage for d1ltod_ (1lto D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465283Protein Alpha tryptase I [89341] (1 species)
  7. 465284Species Human (Homo sapiens) [TaxId:9606] [89342] (1 PDB entry)
  8. 465288Domain d1ltod_: 1lto D: [84710]

Details for d1ltod_

PDB Entry: 1lto (more details), 2.2 Å

PDB Description: Human alpha1-tryptase

SCOP Domain Sequences for d1ltod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltod_ b.47.1.2 (D:) Alpha tryptase I {Human (Homo sapiens)}
ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahclgpdvkdlatlrvql
reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
cagnsqrdsckgdsggplvckvngtwlqagvvswdegcaqpnrpgiytrvtyyldwihhy
vpk

SCOP Domain Coordinates for d1ltod_:

Click to download the PDB-style file with coordinates for d1ltod_.
(The format of our PDB-style files is described here.)

Timeline for d1ltod_: