Class b: All beta proteins [48724] (144 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
Protein Alpha tryptase I [89341] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89342] (1 PDB entry) |
Domain d1ltob_: 1lto B: [84708] |
PDB Entry: 1lto (more details), 2.2 Å
SCOP Domain Sequences for d1ltob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltob_ b.47.1.2 (B:) Alpha tryptase I {Human (Homo sapiens)} ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahclgpdvkdlatlrvql reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml cagnsqrdsckgdsggplvckvngtwlqagvvswdegcaqpnrpgiytrvtyyldwihhy vpk
Timeline for d1ltob_: