Lineage for d1le9b2 (1le9 B:39-250)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 291903Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 292069Superfamily b.2.5: p53-like transcription factors [49417] (6 families) (S)
  5. 292088Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 292092Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 292095Species Mouse (Mus musculus) [TaxId:10090] [49425] (6 PDB entries)
  8. 292104Domain d1le9b2: 1le9 B:39-250 [84594]
    Other proteins in same PDB: d1le9a1, d1le9a2, d1le9b1, d1le9e1, d1le9e2, d1le9f1

Details for d1le9b2

PDB Entry: 1le9 (more details), 3 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to the ig/hiv-kb siti

SCOP Domain Sequences for d1le9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le9b2 b.2.5.3 (B:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki

SCOP Domain Coordinates for d1le9b2:

Click to download the PDB-style file with coordinates for d1le9b2.
(The format of our PDB-style files is described here.)

Timeline for d1le9b2: