SCOPe 2.05: Domain d1le5a2: 1le5 A:18-191

Lineage for d1le5a2 (1le5 A:18-191)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)

8. Domain d1le5a2: 1le5 A:18-191 [84584]
   Other proteins in same PDB: d1le5a1, d1le5b1, d1le5b2, d1le5e1, d1le5f1, d1le5f2
   protein/DNA complex

Details for d1le5a2

PDB Entry: 1le5, 2.75 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to an ifnb-kb

PDB Compounds: (A:) nuclear factor nf-kappa-b p65 subunit

SCOPe Domain Sequences for d1le5a2:

Sequence; same for both SEQRES and ATOM records:

>d1le5a2 b.2.5.3 (A:18-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
mayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislv
tkdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtn
nnpfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

Timeline for d1le5a2:

• d1le5a2 first appeared in SCOP 1.65
  
• d1le5a2 appears in SCOPe 2.04
  
• d1le5a2 appears in SCOPe 2.06
  
• d1le5a2 appears in the current release, SCOPe 2.08