SCOP 1.71: Domain d1k73f_: 1k73 F:

Lineage for d1k73f_ (1k73 F:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family)

5. Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)

6. Protein Ribosomal protein L5 [55284] (3 species)
   synonym: 50S ribosomal protein L5p, HMAL5, HL13

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (19 PDB entries)

8. Domain d1k73f_: 1k73 F: [84321]
   Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73o_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
   complexed with anm, cd, cl, k, mg, na

Details for d1k73f_

PDB Entry: 1k73, 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k73f_:

Sequence, based on SEQRES records:

>d1k73f_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records):

>d1k73f_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

Timeline for d1k73f_:

• d1k73f_ first appeared in SCOP 1.65
  
• d1k73f_ appears in SCOP 1.69
  
• d1k73f_ appears in SCOP 1.73
  
• d1k73f_ appears in the current release, SCOPe 2.08