Lineage for d1k73o_ (1k73 O:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 587067Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 587068Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 587069Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 587070Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (19 PDB entries)
  8. 587087Domain d1k73o_: 1k73 O: [84331]
    Other proteins in same PDB: d1k731_, d1k732_, d1k733_, d1k734_, d1k73c1, d1k73c2, d1k73d_, d1k73e_, d1k73f_, d1k73g1, d1k73g2, d1k73h_, d1k73i_, d1k73j_, d1k73k_, d1k73l_, d1k73m_, d1k73n_, d1k73p_, d1k73q_, d1k73r_, d1k73s_, d1k73t_, d1k73u_, d1k73v_, d1k73w_, d1k73x_, d1k73y_, d1k73z_
    complexed with anm, cd, cl, k, mg, na

Details for d1k73o_

PDB Entry: 1k73 (more details), 3.01 Å

PDB Description: Co-crystal Structure of Anisomycin Bound to the 50S Ribosomal Subunit

SCOP Domain Sequences for d1k73o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k73o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1k73o_:

Click to download the PDB-style file with coordinates for d1k73o_.
(The format of our PDB-style files is described here.)

Timeline for d1k73o_: