Lineage for d1jxsa_ (1jxs A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721762Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 1721780Protein Interleukin enhancer binding factor [88984] (1 species)
  7. 1721781Species Human (Homo sapiens) [TaxId:9606] [88985] (1 PDB entry)
  8. 1721782Domain d1jxsa_: 1jxs A: [84254]

Details for d1jxsa_

PDB Entry: 1jxs (more details)

PDB Description: solution structure of the dna-binding domain of interleukin enhancer binding factor
PDB Compounds: (A:) interleukin enhancer binding factor

SCOPe Domain Sequences for d1jxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxsa_ a.4.5.14 (A:) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]}
dskppysyaqlivqaitmapdkqltlngiythitknypyyrtadkgwqnsirhnlslnry
fikvprsqeepgkgsfwridpasesklieqafrkrrpr

SCOPe Domain Coordinates for d1jxsa_:

Click to download the PDB-style file with coordinates for d1jxsa_.
(The format of our PDB-style files is described here.)

Timeline for d1jxsa_: