Lineage for d1jtsq_ (1jts Q:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728042Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1728065Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 1728118Domain d1jtsq_: 1jts Q: [84222]
    complexed with trs

Details for d1jtsq_

PDB Entry: 1jts (more details), 2.6 Å

PDB Description: dna protection and binding by e. coli dps protein
PDB Compounds: (Q:) DNA protection during starvation protein

SCOPe Domain Sequences for d1jtsq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtsq_ a.25.1.1 (Q:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]}
llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal
ichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr
kaigeakdddtadiltaasrdldkflwfiesnie

SCOPe Domain Coordinates for d1jtsq_:

Click to download the PDB-style file with coordinates for d1jtsq_.
(The format of our PDB-style files is described here.)

Timeline for d1jtsq_: