Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein) |
Protein ATP sulfurylase C-terminal domain [64012] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (7 PDB entries) |
Domain d1j70c3: 1j70 C:390-511 [84126] Other proteins in same PDB: d1j70a1, d1j70a2, d1j70b1, d1j70b2, d1j70c1, d1j70c2 complexed with na, po4 |
PDB Entry: 1j70 (more details), 2.3 Å
SCOPe Domain Sequences for d1j70c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j70c3 c.37.1.15 (C:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs gsgliipnqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff vf
Timeline for d1j70c3: