![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Bacterial beta-amylase [51485] (1 species) protein contains additional starch-binding domain |
![]() | Species Bacillus cereus [TaxId:1396] [51486] (14 PDB entries) |
![]() | Domain d1j18a2: 1j18 A:1-417 [83957] Other proteins in same PDB: d1j18a1 complexed with acy, ca, so4 |
PDB Entry: 1j18 (more details), 2 Å
SCOPe Domain Sequences for d1j18a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j18a2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv
Timeline for d1j18a2: