Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Bacterial beta-amylase [51485] (1 species) protein contains additional starch-binding domain |
Species Bacillus cereus [TaxId:1396] [51486] (14 PDB entries) |
Domain d1j12d2: 1j12 D:1-417 [83955] Other proteins in same PDB: d1j12a1, d1j12b1, d1j12c1, d1j12d1 complexed with ca, ebg |
PDB Entry: 1j12 (more details), 2.1 Å
SCOPe Domain Sequences for d1j12d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j12d2 c.1.8.1 (D:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv
Timeline for d1j12d2: