Lineage for d1j0zd2 (1j0z D:1-417)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339436Protein Bacterial beta-amylase [51485] (1 species)
    protein contains additional starch-binding domain
  7. 1339437Species Bacillus cereus [TaxId:1396] [51486] (14 PDB entries)
  8. 1339464Domain d1j0zd2: 1j0z D:1-417 [83931]
    Other proteins in same PDB: d1j0za1, d1j0zb1, d1j0zc1, d1j0zd1
    complexed with ca

Details for d1j0zd2

PDB Entry: 1j0z (more details), 2.2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with maltose
PDB Compounds: (D:) beta-amylase

SCOPe Domain Sequences for d1j0zd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0zd2 c.1.8.1 (D:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

SCOPe Domain Coordinates for d1j0zd2:

Click to download the PDB-style file with coordinates for d1j0zd2.
(The format of our PDB-style files is described here.)

Timeline for d1j0zd2: