Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
Protein beta-amylase [49462] (1 species) |
Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries) |
Domain d1j0za1: 1j0z A:418-516 [83924] Other proteins in same PDB: d1j0za2, d1j0zb2, d1j0zc2, d1j0zd2 complexed with ca |
PDB Entry: 1j0z (more details), 2.2 Å
SCOPe Domain Sequences for d1j0za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0za1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d1j0za1: