Lineage for d1j0zd1 (1j0z D:418-516)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939144Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 939145Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 939146Protein beta-amylase [49462] (1 species)
  7. 939147Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries)
  8. 939175Domain d1j0zd1: 1j0z D:418-516 [83930]
    Other proteins in same PDB: d1j0za2, d1j0zb2, d1j0zc2, d1j0zd2
    complexed with ca

Details for d1j0zd1

PDB Entry: 1j0z (more details), 2.2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with maltose
PDB Compounds: (D:) beta-amylase

SCOPe Domain Sequences for d1j0zd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0zd1 b.3.1.1 (D:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOPe Domain Coordinates for d1j0zd1:

Click to download the PDB-style file with coordinates for d1j0zd1.
(The format of our PDB-style files is described here.)

Timeline for d1j0zd1: