Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species) |
Species Pyrococcus furiosus [TaxId:2261] [55992] (4 PDB entries) |
Domain d1iz5b2: 1iz5 B:126-246 [83837] mutant |
PDB Entry: 1iz5 (more details), 1.8 Å
SCOPe Domain Sequences for d1iz5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iz5b2 d.131.1.2 (B:126-246) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]} pelpftakvvvlgevlkaavkaaslvsdsikfiarenefimkaegetqeveikltledeg lldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllap r
Timeline for d1iz5b2: