SCOP 1.69: Domain d1iyhc1: 1iyh C:476-599

Lineage for d1iyhc1 (1iyh C:476-599)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (2 PDB entries)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d1iyhc1: 1iyh C:476-599 [83794]
   Other proteins in same PDB: d1iyha2, d1iyhb2, d1iyhc2, d1iyhd2

Details for d1iyhc1

PDB Entry: 1iyh, 1.7 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

SCOP Domain Sequences for d1iyhc1:

Sequence; same for both SEQRES and ATOM records:

>d1iyhc1 a.45.1.1 (C:476-599) Class sigma GST {Human (Homo sapiens)}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d1iyhc1:

• d1iyhc1 first appeared in SCOP 1.65
  
• d1iyhc1 appears in SCOP 1.67
  
• d1iyhc1 appears in SCOP 1.71
  
• d1iyhc1 appears in the current release, SCOPe 2.08