Lineage for d1i6xb1 (1i6x B:138-207)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306440Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2306441Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 2306442Species Escherichia coli [TaxId:562] [46798] (27 PDB entries)
  8. 2306450Domain d1i6xb1: 1i6x B:138-207 [83675]
    Other proteins in same PDB: d1i6xa2, d1i6xb2
    complexed with cmp, trs; mutant

Details for d1i6xb1

PDB Entry: 1i6x (more details), 2.2 Å

PDB Description: structure of a star mutant crp-camp at 2.2 a
PDB Compounds: (B:) catabolite gene activator protein

SCOPe Domain Sequences for d1i6xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6xb1 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d1i6xb1:

Click to download the PDB-style file with coordinates for d1i6xb1.
(The format of our PDB-style files is described here.)

Timeline for d1i6xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i6xb2