Lineage for d1hn0a1 (1hn0 A:235-618)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722434Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2722452Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. 2722453Protein Chondroitin ABC lyase I [89113] (1 species)
    domain 2; preceded by a beta-domain of the galactose-binding domain-like fold
  7. 2722454Species Proteus vulgaris [TaxId:585] [89114] (1 PDB entry)
  8. 2722455Domain d1hn0a1: 1hn0 A:235-618 [83616]
    Other proteins in same PDB: d1hn0a2, d1hn0a3, d1hn0a4
    complexed with na

Details for d1hn0a1

PDB Entry: 1hn0 (more details), 1.9 Å

PDB Description: crystal structure of chondroitin abc lyase i from proteus vulgaris at 1.9 angstroms resolution
PDB Compounds: (A:) chondroitin abc lyase I

SCOPe Domain Sequences for d1hn0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn0a1 a.102.3.2 (A:235-618) Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 585]}
epeiqfhnvkpqlpvtpenlaaidlirqrlinefvggeketnlaleenisklksdfdaln
ihtlanggtqgrhlitdkqiiiyqpenlnsqdkqlfdnyvilgnyttlmfnisrayvlek
dptqkaqlkqmyllmtkhlldqgfvkgsalvtthhwgyssrwwyistllmsdalkeanlq
tqvydsllwysrefkssfdmkvsadssdldyfntlsrqhlallllepddqkrinlvntfs
hyitgaltqvppggkdglrpdgtawrhegnypgysfpafknasqliyllrdtpfsvgesg
wnnlkkamvsawiysnpevglplagrhpfnspslksvaqgyywlamsaksspdktlasiy
laisdktqnestaifgetitpasl

SCOPe Domain Coordinates for d1hn0a1:

Click to download the PDB-style file with coordinates for d1hn0a1.
(The format of our PDB-style files is described here.)

Timeline for d1hn0a1: