Lineage for d1hjvd2 (1hjv D:261-328)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1900344Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1900345Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1900442Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
  7. 1900443Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries)
  8. 1900469Domain d1hjvd2: 1hjv D:261-328 [83507]
    Other proteins in same PDB: d1hjva1, d1hjvb1, d1hjvc1, d1hjvd1
    complexed with nag, so4

Details for d1hjvd2

PDB Entry: 1hjv (more details)

PDB Description: crystal structure of hcgp-39 in complex with chitin tetramer
PDB Compounds: (D:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1hjvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjvd2 d.26.3.1 (D:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOPe Domain Coordinates for d1hjvd2:

Click to download the PDB-style file with coordinates for d1hjvd2.
(The format of our PDB-style files is described here.)

Timeline for d1hjvd2: