SCOPe 2.05: Domain d1gyrc1: 1gyr C:23-160,C:350-386

Lineage for d1gyrc1 (1gyr C:23-160,C:350-386)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein 2,4-dienoyl-CoA reductase [89309] (1 species)

7. Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (6 PDB entries)

8. Domain d1gyrc1: 1gyr C:23-160,C:350-386 [83390]
   Other proteins in same PDB: d1gyra2, d1gyrb2, d1gyrc2
   complexed with gol, so4; mutant

Details for d1gyrc1

PDB Entry: 1gyr, 2.6 Å

PDB Description: mutant form of enoyl thioester reductase from candida tropicalis

PDB Compounds: (C:) 2,4-dienoyl-CoA reductase

SCOPe Domain Sequences for d1gyrc1:

Sequence; same for both SEQRES and ATOM records:

>d1gyrc1 b.35.1.2 (C:23-160,C:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk
pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

Timeline for d1gyrc1:

• d1gyrc1 first appeared in SCOP 1.65
  
• d1gyrc1 appears in SCOPe 2.04
  
• d1gyrc1 appears in SCOPe 2.06
  
• d1gyrc1 appears in the current release, SCOPe 2.08