Lineage for d1ggpb1 (1ggp B:11-140)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 951778Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 951779Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 951838Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 951878Species Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId:3677] [89337] (1 PDB entry)
  8. 951879Domain d1ggpb1: 1ggp B:11-140 [83286]
    Other proteins in same PDB: d1ggpa_
    X-ray derived abrin-based sequence

Details for d1ggpb1

PDB Entry: 1ggp (more details), 2.7 Å

PDB Description: crystal structure of trichosanthes kirilowii lectin-1 and its relation to the type 2 ribosome inactivating proteins
PDB Compounds: (B:) protein (lectin 1 b chain)

SCOPe Domain Sequences for d1ggpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]}
caaatvriagrdgfcadvngegqngaaiilkkcaendnqlwtlkreatirsnggclttaa
aeqakagiydctqataelsaweiadngtiinpasslvlssgaanslldlgvqtnsyasaq
gwrtgn

SCOPe Domain Coordinates for d1ggpb1:

Click to download the PDB-style file with coordinates for d1ggpb1.
(The format of our PDB-style files is described here.)

Timeline for d1ggpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggpb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ggpa_