Lineage for d1e7oa_ (1e7o A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946225Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 946249Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 946250Species Chicken (Gallus gallus) [TaxId:9031] [50059] (27 PDB entries)
  8. 946272Domain d1e7oa_: 1e7o A: [83169]
    complexed with gol; mutant

Details for d1e7oa_

PDB Entry: 1e7o (more details), 3.2 Å

PDB Description: a-spectrin sh3 domain a11v, v23l, m25v, v44i, v58l mutations
PDB Compounds: (A:) spectrin alpha chain

SCOPe Domain Sequences for d1e7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7oa_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
tgkelvlvlydyqekspreltvkkgdiltllnstnkdwwkievndrqgfvpaaylkkld

SCOPe Domain Coordinates for d1e7oa_:

Click to download the PDB-style file with coordinates for d1e7oa_.
(The format of our PDB-style files is described here.)

Timeline for d1e7oa_: