Lineage for d1o96e_ (1o96 E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469682Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 2469704Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 2469709Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)
  8. 2469719Domain d1o96e_: 1o96 E: [81226]
    Other proteins in same PDB: d1o96b1, d1o96b2, d1o96d1, d1o96d2, d1o96f1, d1o96f2, d1o96z1, d1o96z2
    complexed with amp, fad

Details for d1o96e_

PDB Entry: 1o96 (more details), 3.1 Å

PDB Description: structure of electron transferring flavoprotein for methylophilus methylotrophus.
PDB Compounds: (E:) electron transferring flavoprotein beta-subunit

SCOPe Domain Sequences for d1o96e_:

Sequence, based on SEQRES records: (download)

>d1o96e_ c.26.2.3 (E:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
tmiegtiseqaakiiqiinef

Sequence, based on observed residues (ATOM records): (download)

>d1o96e_ c.26.2.3 (E:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeirdgmdvdedfmmydlnewddfsleeamkikessdtdvevvv
vsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagvq
ssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavlt
iqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgrat
miegtiseqaakiiqiinef

SCOPe Domain Coordinates for d1o96e_:

Click to download the PDB-style file with coordinates for d1o96e_.
(The format of our PDB-style files is described here.)

Timeline for d1o96e_: