![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
![]() | Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species) contains an additional FAD-binding domain of DHS-like fold |
![]() | Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries) |
![]() | Domain d1o96d1: 1o96 D:1-191 [81224] Other proteins in same PDB: d1o96a_, d1o96b2, d1o96c_, d1o96d2, d1o96e_, d1o96f2, d1o96q_, d1o96z2 complexed with amp, fad |
PDB Entry: 1o96 (more details), 3.1 Å
SCOPe Domain Sequences for d1o96d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o96d1 c.26.2.3 (D:1-191) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq srsqnkdyvev
Timeline for d1o96d1: