Lineage for d1nlvg_ (1nlv G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427557Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1427558Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1427559Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1427560Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1427577Species Human (Homo sapiens) [TaxId:9606] [55761] (30 PDB entries)
    Uniprot P20065 55-179
  8. 1427594Domain d1nlvg_: 1nlv G: [80632]
    Other proteins in same PDB: d1nlva1, d1nlva2
    domain 1
    complexed with atp, ca, so2, so4

Details for d1nlvg_

PDB Entry: 1nlv (more details), 1.8 Å

PDB Description: Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human Gelsolin Segment 1
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d1nlvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlvg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

SCOPe Domain Coordinates for d1nlvg_:

Click to download the PDB-style file with coordinates for d1nlvg_.
(The format of our PDB-style files is described here.)

Timeline for d1nlvg_: