Lineage for d1nlvg_ (1nlv G:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261128Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 261129Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 261130Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 261131Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 261145Species Human (Homo sapiens) [TaxId:9606] [55761] (15 PDB entries)
  8. 261151Domain d1nlvg_: 1nlv G: [80632]
    Other proteins in same PDB: d1nlva1, d1nlva2
    domain 1
    complexed with atp, ca, so2, so4

Details for d1nlvg_

PDB Entry: 1nlv (more details), 1.8 Å

PDB Description: Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human Gelsolin Segment 1

SCOP Domain Sequences for d1nlvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nlvg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgf

SCOP Domain Coordinates for d1nlvg_:

Click to download the PDB-style file with coordinates for d1nlvg_.
(The format of our PDB-style files is described here.)

Timeline for d1nlvg_: