Lineage for d1nkwu_ (1nkw U:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 272797Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 272798Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (10 PDB entries)
  8. 273084Domain d1nkwu_: 1nkw U: [80606]

Details for d1nkwu_

PDB Entry: 1nkw (more details), 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans

SCOP Domain Sequences for d1nkwu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkwu_ i.1.1.2 (U:) 50S subunit {Deinococcus radiodurans}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaqte

SCOP Domain Coordinates for d1nkwu_:

Click to download the PDB-style file with coordinates for d1nkwu_.
(The format of our PDB-style files is described here.)

Timeline for d1nkwu_: