Class i: Low resolution protein structures [58117] (18 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Domain d1nkwf_: 1nkw F: [80591] |
PDB Entry: 1nkw (more details), 3.1 Å
SCOP Domain Sequences for d1nkwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nkwf_ i.1.1.2 (F:) 50S subunit {Deinococcus radiodurans} mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
Timeline for d1nkwf_:
View in 3D Domains from other chains: (mouse over for more information) d1nkw0_, d1nkw1_, d1nkw2_, d1nkw3_, d1nkw4_, d1nkw9_, d1nkwa_, d1nkwb_, d1nkwc_, d1nkwd_, d1nkwe_, d1nkwg_, d1nkwh_, d1nkwi_, d1nkwj_, d1nkwk_, d1nkwl_, d1nkwm_, d1nkwn_, d1nkwo_, d1nkwp_, d1nkwq_, d1nkwr_, d1nkws_, d1nkwt_, d1nkwu_, d1nkww_, d1nkwx_, d1nkwy_, d1nkwz_ |