SCOP 1.63: Domain d1nkwf_: 1nkw F:

Lineage for d1nkwf_ (1nkw F:)

1. Root: SCOP 1.63

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)
6. Protein 50S subunit [58125] (3 species)
7. Species Deinococcus radiodurans [TaxId:1299] [69993] (10 PDB entries)

8. Domain d1nkwf_: 1nkw F: [80591]

Details for d1nkwf_

PDB Entry: 1nkw, 3.1 Å

PDB Description: Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans

SCOP Domain Sequences for d1nkwf_:

Sequence; same for both SEQRES and ATOM records:

>d1nkwf_ i.1.1.2 (F:) 50S subunit {Deinococcus radiodurans}
mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs

Timeline for d1nkwf_:

• d1nkwf_ is new in SCOP 1.63
  
• d1nkwf_ appears in SCOP 1.65
  
• d1nkwf_ appears in the current release, SCOPe 2.08