SCOP 1.63: Domain d1ni2b2: 1ni2 B:199-297

Lineage for d1ni2b2 (1ni2 B:199-297)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (6 families)

5. Family b.55.1.5: Third domain of FERM [50776] (6 proteins)

6. Protein Ezrin [82142] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82143] (1 PDB entry)

8. Domain d1ni2b2: 1ni2 B:199-297 [80529]
   Other proteins in same PDB: d1ni2a1, d1ni2a3, d1ni2b1, d1ni2b3

Details for d1ni2b2

PDB Entry: 1ni2, 2.3 Å

PDB Description: structure of the active ferm domain of ezrin

SCOP Domain Sequences for d1ni2b2:

Sequence; same for both SEQRES and ATOM records:

>d1ni2b2 b.55.1.5 (B:199-297) Ezrin {Human (Homo sapiens)}
emyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkp

Timeline for d1ni2b2:

• d1ni2b2 is new in SCOP 1.63
  
• d1ni2b2 appears in SCOP 1.65
  
• d1ni2b2 appears in the current release, SCOPe 2.08